PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.103200.1
Common NameCsa_6G495660, LOC101212559
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 240aa    MW: 26841.3 Da    PI: 10.2794
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.103200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.92e-072164344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     +WT   d l+ +a  + + +   +W +Ia+ ++ g+++ +++ ++
   Cucsa.103200.1 21 PWTRHQDNLFEHALVLVPDNspdRWIKIAALVP-GKSAADVRYHY 64
                     8*****************99*************.**********9 PP

2Myb_DNA-binding40.94.7e-13119164247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+ E++l++ + k++G+g+W++I+r    +Rt+ q+ s+ qky
   Cucsa.103200.1 119 KPWTKKEHQLFLLGLKKFGKGDWRSISRNAVITRTPTQVASHAQKY 164
                      58*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512935.941771IPR017884SANT domain
SMARTSM007178.5E-61870IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-112076IPR009057Homeodomain-like
CDDcd001671.00E-52164No hitNo description
PROSITE profilePS5129418.504113169IPR017930Myb domain
SuperFamilySSF466895.53E-16114170IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-16116168IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.8E-11117163IPR009057Homeodomain-like
SMARTSM007179.8E-11117167IPR001005SANT/Myb domain
PfamPF002491.6E-11119164IPR001005SANT/Myb domain
CDDcd001677.41E-10120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MEPHSPSFGL FPVASLSSPT PWTRHQDNLF EHALVLVPDN SPDRWIKIAA LVPGKSAADV  60
RYHYDVLVSD VLDIDSGRVE LPNYADDLTV AKSSERERSP PSPRPVSEKT STTERKKGKP  120
WTKKEHQLFL LGLKKFGKGD WRSISRNAVI TRTPTQVASH AQKYFLRQES AKKDRKRSSI  180
HDITTVEGSL VTTSTTAIGQ SQPSILSVTQ PLSSSFPLHM RHQFASSGYF PYRRSLLDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-141384273RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-130LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-130LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141984.11e-175PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-54DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KJP91e-175A0A0A0KJP9_CUCSA; Uncharacterized protein
STRINGVIT_06s0080g00790.t019e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-48MYB family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]